PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 369aa    MW: 41460.3 Da    PI: 5.6486
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619219.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.7e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++  G+g +W + ++++g++R++k+c++rw++yl
   XP_013619219.1 14 KGPWSPEEDAKLKDYIESSGTGgNWIALPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.7e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
   XP_013619219.1  69 GGFSEEEDNIICNLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.88962IPR017930Myb domain
SuperFamilySSF466899.8E-2611109IPR009057Homeodomain-like
SMARTSM007173.8E-111364IPR001005SANT/Myb domain
PfamPF002496.6E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231569IPR009057Homeodomain-like
CDDcd001677.27E-81662No hitNo description
PROSITE profilePS5129421.38563117IPR017930Myb domain
SMARTSM007172.2E-1167115IPR001005SANT/Myb domain
PfamPF002496.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370117IPR009057Homeodomain-like
CDDcd001675.59E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE SSGTGGNWIA LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC NLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLNK  120
QRKEFQEARM KQEMVMMKRQ QQGQCQSNGS TDLYLNNMFG SSPWPLLPQL PPPHCQVPLV  180
MMEPTSCNYY QPTPSCALEQ KPLIPLKNMV KIEEEPERSN PDHHYPEDSM TNSFDLSFSQ  240
LLLDPNYYLE SGGGEGEFAL MSSSTNSPLP NTSDDHHQHQ KEITQWFGSG NFQTEAINDV  300
FLNNNNLANF ETNDENAKLY ANSSVTGAGA AFAGGTTSTS ADQSTISWED ITSLLKSDDA  360
SYFNGPNHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2022850.0HQ202285.1 Brassica oleracea var. botrytis MYB-like protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619219.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-127RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D3AYZ00.0A0A0D3AYZ0_BRAOL; Uncharacterized protein
TrEMBLE5KL130.0E5KL13_BRAOB; MYB-like protein
STRINGBra031847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.11e-162myb domain protein 68